PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01629.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 392aa    MW: 45315.4 Da    PI: 6.2301
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01629.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.61.4e-5471361129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyW 83 
                              +ppGfrFhPtdeelv++yL+kkv++k++e+ ++ik++d+yk+ePwdL +  k+ +ee+ +wyfFs++dkky+tg+r+nratk+g+W
  Rsa1.0_01629.1_g00002.1   7 VPPGFRFHPTDEELVDYYLRKKVASKRIEI-DFIKDIDLYKIEPWDLLElcKIGHEEQsDWYFFSHKDKKYPTGTRTNRATKAGFW 91 
                              69****************************.99**************7434554444459************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              katg+dk+++  +++l+g++ktLvfy grap+g+k+dW+mheyrle
  Rsa1.0_01629.1_g00002.1  92 KATGRDKAIYL-RHSLIGMRKTLVFYMGRAPNGQKSDWIMHEYRLE 136
                              ***********.8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.67E-605156IPR003441NAC domain
PROSITE profilePS5100558.5227156IPR003441NAC domain
PfamPF023651.1E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVA SKRIEIDFIK DIDLYKIEPW DLLELCKIGH  60
EEQSDWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YLRHSLIGMR KTLVFYMGRA  120
PNGQKSDWIM HEYRLETDEN GIPQEEGWVV CRVFKKRLPA VIRRMGDYDS SPSHWYDDQL  180
SFMASELETN GPRRLIPNHH QQHQQPLPYG LNASAYALNS PNLQCKQELE LQYNHLVQHH  240
HFLHESNLSP LQLPQFESSK IQLDNINCNS LSCGTSNNVN NSTDLANLQQ SNLPHEEQLN  300
QGNHSFSSLY MNGGNEQTME KVTDWRALDK FVASQLSNDE ADTASASLQN NAKDTSNLEH  360
QVDEEKDQKR VSDMGEEYAA STSSSCQIDL WK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-50615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0297610.0BT029761.1 Arabidopsis thaliana At1g12260 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172690.10.0NAC domain-containing protein 7
SwissprotQ9FWX20.0NAC7_ARATH; NAC domain-containing protein 7
TrEMBLD7KNA90.0D7KNA9_ARALL; Putative uncharacterized protein
STRINGAT1G12260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21112678
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.10.0NAC 007